Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T88452
|
||||
Former ID |
TTDS00068
|
||||
Target Name |
Corticosteroid-binding globulin
|
||||
Gene Name |
SERPINA6
|
||||
Synonyms |
CBG; Transcortin; SERPINA6
|
||||
Target Type |
Successful
|
||||
Disease | Asthma; Obstructive airway diseases [ICD9:490-492, 494-496; ICD10: J45, J40-J44, J47] | ||||
Diabetic macular edema [ICD9: 250, 362.01, 362.07, 362.53, 782.3; ICD10: E08-E13, E08.3, E09.3, E10.3, E11.3, E13.3, H35.8, R60.9] | |||||
Diabetic retinopathy [ICD9: 250.5; ICD10: H36, E10.3, E11.3, E13.3] | |||||
Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
Function |
Major transport protein for glucocorticoids and progestins in the blood of almost all vertebrate species.
|
||||
BioChemical Class |
Serpin family
|
||||
Target Validation |
T88452
|
||||
UniProt ID | |||||
Sequence |
MPLLLYTCLLWLPTSGLWTVQAMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPK
KNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSD TSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQG KIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTI SYLHDSELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLY IPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDT AGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV |
||||
Drugs and Mode of Action | |||||
Drug(s) | Alclometasone | Drug Info | Approved | Inflammatory disease | [536361] |
Ciclesonide | Drug Info | Approved | Asthma; Obstructive airway diseases | [528715], [536958], [542493], [551871] | |
Paramethasone | Drug Info | Approved | Inflammatory disease | [538461] | |
Paramethasone | Drug Info | Phase 3 | Diabetic macular edema | [551871] | |
I-vation | Drug Info | Phase 2 | Diabetic retinopathy | [532534] | |
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
References | |||||
Ref 532534 | Drug delivery implants in the treatment of vitreous inflammation. Mediators Inflamm. 2013;2013:780634. | ||||
Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
Ref 538461 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 012772. | ||||
Ref 534951 | Novel human corticosteroid-binding globulin variant with low cortisol-binding affinity. J Clin Endocrinol Metab. 2000 Jan;85(1):361-7. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.