Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T07087
|
||||
Former ID |
TTDI02472
|
||||
Target Name |
Focal adhesion kinase-2
|
||||
Gene Name |
PTK2B
|
||||
Synonyms |
CADTK; CAK-beta; CAKB; Calcium-dependent tyrosine kinase; Calcium-regulated non-receptor proline-rich tyrosine kinase; Cell adhesion kinase beta; FADK 2; Proline-rich tyrosine kinase 2; Protein-tyrosine kinase 2-beta; RAFTK; Related adhesion focal tyrosine kinase; PTK2B
|
||||
Target Type |
Research
|
||||
Disease | Osteoporosis [ICD9: 733.0, V07.4; ICD10: M80-M81, Z79.890] | ||||
Function |
Non-receptor protein-tyrosine kinase that regulates reorganization of the actin cytoskeleton, cell polarization, cell migration, adhesion, spreading and bone remodeling. Plays a role in the regulation of the humoral immune response, and is required for normal levels of marginal B-cells in the spleen and normal migration of splenic B-cells. Required for normal macrophage polarization and migration towards sites of inflammation. Regulates cytoskeleton rearrangement and cell spreading in T- cells, and contributes to the regulation of T-cell responses. Promotes osteoclastic bone resorption; this requires both PTK2B/PYK2 and SRC. May inhibit differentiation and activity of osteoprogenitor cells. Functions in signaling downstream of integrin and collagen receptors, immune receptors, G-protein coupled receptors (GPCR), cytokine, chemokine and growth factor receptors, and mediates responses to cellular stress. Forms multisubunit signaling complexes with SRC and SRC family members upon activation; this leads to the phosphorylation of additional tyrosine residues, creating binding sites for scaffold proteins, effectors and substrates. Regulates numerous signaling pathways. Promotes activation of phosphatidylinositol 3-kinase and of the AKT1 signaling cascade. Promotes activation of NOS3. Regulates production of the cellular messenger cGMP. Promotes activation of the MAP kinase signaling cascade, including activation of MAPK1/ERK2, MAPK3/ERK1 and MAPK8/JNK1. Promotes activation of Rho family GTPases, such as RHOA and RAC1. Recruits the ubiquitin ligase MDM2 to P53/TP53 in the nucleus, and thereby regulates P53/TP53 activity, P53/TP53 ubiquitination and proteasomal degradation. Acts as a scaffold, binding to both PDPK1 and SRC, thereby allowing SRC to phosphorylate PDPK1 at 'Tyr-9, 'Tyr-373', and 'Tyr-376'. Promotes phosphorylation of NMDA receptors by SRC family members, and thereby contributes to the regulation of NMDA receptor ion channel activity and intracellular Ca(2+) levels. May also regulate potassium ion transport by phosphorylation of potassium channel subunits. Phosphorylates SRC; this increases SRC kinase activity. Phosphorylates ASAP1, NPHP1, KCNA2 and SHC1. Promotes phosphorylation of ASAP2, RHOU and PXN; this requires both SRC and PTK2/PYK2.
|
||||
BioChemical Class |
Kinase
|
||||
UniProt ID | |||||
EC Number |
EC 2.7.10.2
|
||||
Sequence |
MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG SLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR CWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRP KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR EEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE |
||||
Pathways | |||||
KEGG Pathway | Calcium signaling pathway | ||||
Chemokine signaling pathway | |||||
Natural killer cell mediated cytotoxicity | |||||
Leukocyte transendothelial migration | |||||
GnRH signaling pathway | |||||
Hepatitis B | |||||
NetPath Pathway | TCR Signaling Pathway | ||||
PANTHER Pathway | Inflammation mediated by chemokine and cytokine signaling pathway | ||||
Integrin signalling pathway | |||||
CCKR signaling map ST | |||||
Pathway Interaction Database | Endothelins | ||||
LPA receptor mediated events | |||||
Coregulation of Androgen receptor activity | |||||
Osteopontin-mediated events | |||||
IL2-mediated signaling events | |||||
CXCR4-mediated signaling events | |||||
Integrins in angiogenesis | |||||
Signaling events mediated by VEGFR1 and VEGFR2 | |||||
Alpha-synuclein signaling | |||||
FGF signaling pathway | |||||
Alpha4 beta1 integrin signaling events | |||||
Reactome | Signal regulatory protein (SIRP) family interactions | ||||
VEGFA-VEGFR2 Pathway | |||||
Interleukin-2 signaling | |||||
WikiPathways | TCR Signaling Pathway | ||||
IL-2 Signaling Pathway | |||||
Signaling of Hepatocyte Growth Factor Receptor | |||||
Apoptosis-related network due to altered Notch3 in ovarian cancer | |||||
Interleukin-2 signaling | |||||
Nifedipine Activity | |||||
BDNF signaling pathway | |||||
Oncostatin M Signaling Pathway | |||||
Prostate Cancer | |||||
IL-7 Signaling Pathway | |||||
Signal regulatory protein (SIRP) family interactions | |||||
References |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.