Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T93878
(Former ID: TTDS00116)
|
|||||
Target Name |
Solute carrier family 12 member 1 (SLC12A1)
|
|||||
Synonyms |
Solute carrier family 12 member; SLC12A1; Na+/K+/2CL- co-transporter; NKCC2; Kidney-specific Na-K-Cl symporter; Bumetanide-sensitive sodium-(potassium)Solute carrier family 12 member 1-chloride cotransporter 2; Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2
Click to Show/Hide
|
|||||
Gene Name |
SLC12A1
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 5 Target-related Diseases | + | ||||
1 | Essential hypertension [ICD-11: BA00] | |||||
2 | Heart failure [ICD-11: BD10-BD1Z] | |||||
3 | Hypertension [ICD-11: BA00-BA04] | |||||
4 | Hypo-kalaemia [ICD-11: 5C77] | |||||
5 | Oedema [ICD-11: MG29] | |||||
Function |
Electrically silent transporter system. Mediates sodium and chloride reabsorption. Plays a vital role in the regulation of ionic balance and cell volume.
Click to Show/Hide
|
|||||
BioChemical Class |
Cation-chloride cotransporter
|
|||||
UniProt ID | ||||||
Sequence |
MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRI
SFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGS ISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQAGVVKFGWV KGVLVRCMLNIWGVMLFIRLSWIVGEAGIGLGVLIILLSTMVTSITGLSTSAIATNGFVR GGGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFAETVVDLLKESDSMMVDPTND IRIIGSITVVILLGISVAGMEWEAKAQVILLVILLIAIANFFIGTVIPSNNEKKSRGFFN YQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANISGDLEDPQDAIPRGTMLAIF ITTVAYLGVAICVGACVVRDATGNMNDTIISGMNCNGSAACGLGYDFSRCRHEPCQYGLM NNFQVMSMVSGFGPLITAGIFSATLSSALASLVSAPKVFQALCKDNIYKALQFFAKGYGK NNEPLRGYILTFLIAMAFILIAELNTIAPIISNFFLASYALINFSCFHASYAKSPGWRPA YGIYNMWVSLFGAVLCCAVMFVINWWAAVITYVIEFFLYVYVTCKKPDVNWGSSTQALSY VSALDNALELTTVEDHVKNFRPQCIVLTGGPMTRPALLDITHAFTKNSGLCICCEVFVGP RKLCVKEMNSGMAKKQAWLIKNKIKAFYAAVAADCFRDGVRSLLQASGLGRMKPNTLVIG YKKNWRKAPLTEIENYVGIIHDAFDFEIGVVIVRISQGFDISQVLQVQEELERLEQERLA LEATIKDNECEEESGGIRGLFKKAGKLNITKTTPKKDGSINTSQSMHVGEFNQKLVEAST QFKKKQEKGTIDVWWLFDDGGLTLLIPYILTLRKKWKDCKLRIYVGGKINRIEEEKIVMA SLLSKFRIKFADIHIIGDINIRPNKESWKVFEEMIEPYRLHESCKDLTTAEKLKRETPWK ITDAELEAVKEKSYRQVRLNELLQEHSRAANLIVLSLPVARKGSISDLLYMAWLEILTKN LPPVLLVRGNHKNVLTFYS Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 10 Approved Drugs | + | ||||
1 | Aldosterone | Drug Info | Approved | Hypertension | [5], [6] | |
2 | Bendroflumethiazide | Drug Info | Approved | High blood pressure | [7], [8] | |
3 | Bumetanide | Drug Info | Approved | Congestive heart failure | [9], [10] | |
4 | Chlorthalidone | Drug Info | Approved | Edema | [4], [11], [12] | |
5 | Ethacrynic acid | Drug Info | Approved | High blood pressure | [13], [14] | |
6 | Furosemide | Drug Info | Approved | Congestive heart failure | [15], [16] | |
7 | Hydroflumethiazide | Drug Info | Approved | Congestive heart failure | [4], [17], [18] | |
8 | Methyclothiazide | Drug Info | Approved | Edema | [4], [19], [20] | |
9 | Potassium Chloride | Drug Info | Approved | Hypokalemia | [21] | |
10 | Torasemide | Drug Info | Approved | Congestive heart failure | [22], [23] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Blocker | [+] 11 Blocker drugs | + | ||||
1 | Aldosterone | Drug Info | [24], [25] | |||
2 | Bendroflumethiazide | Drug Info | [26] | |||
3 | Bumetanide | Drug Info | [1], [27] | |||
4 | Chlorthalidone | Drug Info | [28] | |||
5 | Ethacrynic acid | Drug Info | [29], [30] | |||
6 | Furosemide | Drug Info | [31] | |||
7 | Hydroflumethiazide | Drug Info | [26] | |||
8 | Methyclothiazide | Drug Info | [26] | |||
9 | Torasemide | Drug Info | [33], [34], [35] | |||
10 | Calyculin-A | Drug Info | [36] | |||
11 | Piretanide | Drug Info | [38], [39], [40] | |||
Modulator | [+] 2 Modulator drugs | + | ||||
1 | Potassium Chloride | Drug Info | [32] | |||
2 | CL-301 | Drug Info | [37] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
There is no similarity protein (E value < 0.005) for this target
|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 3 KEGG Pathways | + | ||||
1 | Salivary secretion | |||||
2 | Pancreatic secretion | |||||
3 | Vibrio cholerae infection | |||||
Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | ||||
1 | Kidney Function | |||||
Reactome | [+] 1 Reactome Pathways | + | ||||
1 | Cation-coupled Chloride cotransporters | |||||
WikiPathways | [+] 4 WikiPathways | + | ||||
1 | miR-targeted genes in squamous cell - TarBase | |||||
2 | miR-targeted genes in muscle cell - TarBase | |||||
3 | miR-targeted genes in lymphocytes - TarBase | |||||
4 | miR-targeted genes in epithelium - TarBase |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Nerve Terminal GABAA Receptors Activate Ca2+/Calmodulin-dependent Signaling to Inhibit Voltage-gated Ca2+ Influx and Glutamate Release. J Biol Chem. 2009 Mar 27;284(13):8726-37. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7314). | |||||
REF 3 | Current usage of diuretics among hypertensive patients in Japan: the Japan Home versus Office Blood Pressure Measurement Evaluation (J-HOME) study. Hypertens Res. 2006 Nov;29(11):857-63. | |||||
REF 4 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2872). | |||||
REF 6 | Treatment of hypertension with olmesartan medoxomil, alone and in combination with a diuretic: an update. J Hum Hypertens. 2007 Sep;21(9):699-708. | |||||
REF 7 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7122). | |||||
REF 8 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 077833. | |||||
REF 9 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4837). | |||||
REF 10 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 074225. | |||||
REF 11 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7147). | |||||
REF 12 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 086831. | |||||
REF 13 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7179). | |||||
REF 14 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016092. | |||||
REF 15 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4839). | |||||
REF 16 | Targeting the kidney in acute decompensated heart failure: conventional diuretics and renal-acting vasodilators. Rev Cardiovasc Med. 2008 Winter;9(1):39-45. | |||||
REF 17 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7197). | |||||
REF 18 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 088850. | |||||
REF 19 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7235). | |||||
REF 20 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 087672. | |||||
REF 21 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 070999. | |||||
REF 22 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7312). | |||||
REF 23 | Drug information of Torasemide, 2008. eduDrugs. | |||||
REF 24 | Nongenomic effect of aldosterone on ion transport pathways of red blood cells. Cell Physiol Biochem. 2008;22(1-4):269-78. | |||||
REF 25 | Aldosterone regulates the Na-K-2Cl cotransporter in vascular smooth muscle. Hypertension. 2003 May;41(5):1131-5. | |||||
REF 26 | DrugBank: a knowledgebase for drugs, drug actions and drug targets. Nucleic Acids Res. 2008 Jan;36(Database issue):D901-6. | |||||
REF 27 | Effect of L-ascorbate on chloride transport in freshly excised sinonasal epithelia. Am J Rhinol Allergy. 2009 May-Jun;23(3):294-9. | |||||
REF 28 | The 45-year story of the development of an anti-aldosterone more specific than spironolactone. Mol Cell Endocrinol. 2004 Mar 31;217(1-2):45-52. | |||||
REF 29 | Na-K-Cl cotransport regulates intracellular volume and monolayer permeability of trabecular meshwork cells. Am J Physiol. 1995 Apr;268(4 Pt 1):C1067-74. | |||||
REF 30 | Inhibition of Na-K-2Cl cotransport and bumetanide binding by ethacrynic acid, its analogues, and adducts. Am J Physiol. 1993 May;264(5 Pt 1):C1270-7. | |||||
REF 31 | Update of diuretics in the treatment of hypertension. Am J Ther. 2007 Mar-Apr;14(2):154-60. | |||||
REF 32 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||||
REF 33 | Genetic variation in the renal sodium transporters NKCC2, NCC, and ENaC in relation to the effects of loop diuretic drugs. Clin Pharmacol Ther. 2007 Sep;82(3):300-9. | |||||
REF 34 | Effects of loop diuretics on angiotensin II-stimulated vascular smooth muscle cell growth. Nephrol Dial Transplant. 2001;16 Suppl 1:14-7. | |||||
REF 35 | Torasemide inhibits angiotensin II-induced vasoconstriction and intracellular calcium increase in the aorta of spontaneously hypertensive rats. Hypertension. 1999 Jul;34(1):138-43. | |||||
REF 36 | Involvement of K(+)-Cl(-)-cotransport in the apoptosis induced by N-ethylmaleimide in HepG2 human hepatoblastoma cells. Eur J Pharmacol. 2001 Apr 20;418(1-2):1-5. | |||||
REF 37 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 969). | |||||
REF 38 | Peripheral and central antinociceptive action of Na+-K+-2Cl- cotransporter blockers on formalin-induced nociception in rats. Pain. 2005 Mar;114(1-2):231-8. | |||||
REF 39 | Rat NKCC2/NKCC1 cotransporter selectivity for loop diuretic drugs. Naunyn Schmiedebergs Arch Pharmacol. 2002 Mar;365(3):193-9. | |||||
REF 40 | Piretanide, a potent diuretic with potassium-sparing properties, for the treatment of congestive heart failure. Clin Pharmacol Ther. 1986 Nov;40(5):587-94. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.