Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T04902
|
||||
Former ID |
TTDR00505
|
||||
Target Name |
Calpain
|
||||
Gene Name |
CAPN2
|
||||
Synonyms |
CANP; Calcium-activated neutral proteinase; CAPN2
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
Cerebral infarction [ICD10: I63] | |||||
Neurological disease [ICD9: 338, 338.2, 410, 782.3,780; ICD10: I21, I22, R52, R52.1-R52.2, R60.9, G89] | |||||
Trematode infection [ICD10: B66.9] | |||||
Function |
Calcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction.
|
||||
BioChemical Class |
Peptidase
|
||||
Target Validation |
T04902
|
||||
UniProt ID | |||||
EC Number |
EC 3.4.22.52
|
||||
Sequence |
MAGIAAKLAKDREAAEGLGSHDRAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGF
KELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEI LARVVPLNQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGC SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDN CPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTK MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQR KMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPG EYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQ LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFD NFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL |
||||
Structure |
1KFU; 1KFX; 2NQA; 1ZCM; 2ARY
|
||||
Drugs and Mode of Action | |||||
Drug(s) | ABT-957 | Drug Info | Phase 1 | Alzheimer disease | [1] |
BITHIONOL | Drug Info | Withdrawn from market | Trematode infection | [2], [3] | |
Aloxistatin | Drug Info | Discontinued in Phase 3 | Neurological disease | [4] | |
AK-295 | Drug Info | Terminated | Cerebral infarction | [5] | |
MDL-2170 | Drug Info | Terminated | Discovery agent | [6] | |
MDL-28170 | Drug Info | Terminated | Alzheimer disease | [6] | |
SJA-6017 | Drug Info | Terminated | Discovery agent | [7] | |
Inhibitor | (1-Benzyl-2-oxo-ethyl)-carbamic acid benzyl ester | Drug Info | [8] | ||
3-(1H-Pyrrol-3-yl)-propionamide | Drug Info | [9] | |||
A-558693 | Drug Info | [10] | |||
AK-295 | Drug Info | [10] | |||
Aloxistatin | Drug Info | [11] | |||
AW-00430 | Drug Info | [11] | |||
BITHIONOL | Drug Info | [11] | |||
Calpastatin | Drug Info | [12], [13] | |||
compound 19 | Drug Info | [14] | |||
compound 4b | Drug Info | [15] | |||
compound 5a | Drug Info | [15] | |||
DIHYDROXANTHOHUMOL | Drug Info | [11] | |||
GNF-PF-4453 | Drug Info | [11] | |||
MDL-2170 | Drug Info | [16] | |||
MDL-28170 | Drug Info | [17] | |||
mercaptoacrylate inhibitor of calpain 1 | Drug Info | [10] | |||
N-(1-Benzyl-2-oxo-ethyl)-benzamide | Drug Info | [8] | |||
SJA-6017 | Drug Info | [18] | |||
Modulator | ABT-957 | Drug Info | [19] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Protein processing in endoplasmic reticulum | ||||
Apoptosis | |||||
Alzheimer' | |||||
s disease | |||||
Reactome | Degradation of the extracellular matrix | ||||
WikiPathways | Focal Adhesion | ||||
Integrated Pancreatic Cancer Pathway | |||||
Alzheimers Disease | |||||
Integrin-mediated Cell Adhesion | |||||
References | |||||
REF 1 | ClinicalTrials.gov (NCT02220738) Study to Evaluate the Safety, Tolerability, and Pharmacokinetics of ABT-957 in Subjects With Mild-to-Moderate Alzheimer's Disease on Stable Doses of Acetylcholinesterase Inhibitors. U.S. National Institutes of Health. | ||||
REF 2 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2338). | ||||
REF 3 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | ||||
REF 4 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002441) | ||||
REF 5 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007674) | ||||
REF 6 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003692) | ||||
REF 7 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008985) | ||||
REF 8 | J Med Chem. 1990 Jan;33(1):11-3.Alpha-diketone and alpha-keto ester derivatives of N-protected amino acids and peptides as novel inhibitors of cysteine and serine proteinases. | ||||
REF 9 | Synthesis of cystamidin a (pyrrole-3-propanamide), a reported calpain inhibitor, Bioorg. Med. Chem. Lett. 6(13):1541-1542 (1996). | ||||
REF 10 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2336). | ||||
REF 11 | Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. Epub 2010 Oct 21.In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). | ||||
REF 12 | Calpain in the pathophysiology of spinal cord injury: neuroprotection with calpain inhibitors. Brain Res Brain Res Rev. 2003 May;42(2):169-85. | ||||
REF 13 | PEST sequences in the malaria parasite Plasmodium falciparum: a genomic study. Malar J. 2003 Jun 23;2:16. Epub 2003 Jun 23. | ||||
REF 14 | Novel peptidyl alpha-keto amide inhibitors of calpains and other cysteine proteases. J Med Chem. 1996 Sep 27;39(20):4089-98. | ||||
REF 15 | Peptidyl alpha-ketoamides with nucleobases, methylpiperazine, and dimethylaminoalkyl substituents as calpain inhibitors. J Med Chem. 2010 Sep 9;53(17):6326-36. | ||||
REF 16 | Bioorg Med Chem Lett. 2009 Jan 15;19(2):502-7. Epub 2008 Nov 14.Design and synthesis of 4-aryl-4-oxobutanoic acid amides as calpain inhibitors. | ||||
REF 17 | Bioorg Med Chem Lett. 2005 Jun 15;15(12):3034-8.Synthesis of a small library of diketopiperazines as potential inhibitors of calpain. | ||||
REF 18 | Bioorg Med Chem. 2008 Jul 15;16(14):6911-23. Epub 2008 May 27.Synthesis, biological evaluation and molecular modelling of N-heterocyclic dipeptide aldehydes as selective calpain inhibitors. | ||||
REF 19 | Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.