Target Regulator(s) Information (Transcription Factor)

Content Navigation (  All   None )                                      
Target General Information
The Transcription Factors (TFs) Regulating This Target
References
Target General Information  Top
Target ID T16180 Target Info
Target Name Transcription factor E2F2 (E2F2)
Synonyms E2F-2
Target Type Literature-reported Target
Gene Name E2F2
UniProt ID
E2F2_HUMAN
The Transcription Factors (TFs) Regulating This Target  Top
TF Name c-Myc proto-oncogene (MYC)
Classification Superclass Basic Domains
Class Helix-loop-helix / leucine zipper factors (bHLH-ZIP)
Family Cell-cycle controlling factors
Subfamily Myc
Regulation Mechanism Sequence comparison reveals the presence of a variety of known transcription factor binding sites, including E-box elements that are consensus MYC binding sites, as well as E2F binding sites. The E-box elements, which we show can function as MYC-responsive sites, contribute in a positive fashion to promoter function. [1]
Evidence Score (E-score) 2 +
1 Electrophoretic Mobility Shift Assay [1]
2 Luciferase Reporter Assay [2]
UniProt ID
MYC_HUMAN
Sequence
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL
RKRREQLKHKLEQLRNSCA
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Eukaryotic initiation factors [+] 1 Eukaryotic initiation factors Co-regulated By This TF +
1 Eukaryotic initiation factor 4E (EIF4E) Literature-reported Target Target Info [3]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 C-X-C chemokine receptor type 4 (CXCR4) Successful Target Target Info [4]
Kinases [+] 2 Kinases Co-regulated By This TF +
1 Erbb2 tyrosine kinase receptor (HER2) Successful Target Target Info [5]
2 Telomerase reverse transcriptase (TERT) Clinical trial Target Target Info [6]
Lyases [+] 1 Lyases Co-regulated By This TF +
1 Ornithine decarboxylase (ODC1) Successful Target Target Info [7]
Transcription factors [+] 1 Transcription factors Co-regulated By This TF +
1 Transcription factor E2F2 (E2F2) Literature-reported Target Target Info [1]
TF Name E2F transcription factor homodimer
Classification Superclass Helix-turn-helix
Class Fork head / winged helix
Regulation Mechanism Sequence comparison reveals the presence of a variety of known transcription factor binding sites, including E-box elements that are consensus MYC binding sites, as well as E2F binding sites. The E-box elements, which we show can function as MYC-responsive sites, contribute in a positive fashion to promoter function. [1]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay [1]
UniProt ID
E2F1_HUMAN; E2F2_HUMAN; E2F3_HUMAN; E2F4_HUMAN; E2F5_HUMAN; E2F6_HUMAN; E2F7_HUMAN; E2F8_HUMAN
Sequence
MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCD
PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK
SPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
AKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDS
QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPE
ETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLS
RMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG
IRDLFDCDFGDLTPLDF
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Caveolin proteins [+] 1 Caveolin proteins Co-regulated By This TF +
1 Caveolin 1 (CAV1) Literature-reported Target Target Info [8]
Kinases [+] 1 Kinases Co-regulated By This TF +
1 Thymidine kinase 1 (TK1) Successful Target Target Info [9]
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Dihydrofolate reductase (DHFR) Successful Target Target Info [10]
Transcription factors [+] 1 Transcription factors Co-regulated By This TF +
1 Transcription factor E2F2 (E2F2) Literature-reported Target Target Info [1]
References  Top
REF 1 Identification of positively and negatively acting elements regulating expression of the E2F2 gene in response to cell growth signals. Mol Cell Biol. 1997 Sep;17(9):5227-35.
REF 2 miR-31 promotes proliferation of colon cancer cells by targeting E2F2. Biotechnol Lett. 2015 Mar;37(3):523-32.
REF 3 An essential E box in the promoter of the gene encoding the mRNA cap-binding protein (eukaryotic initiation factor 4E) is a target for activation by c-myc. Mol Cell Biol. 1996 Sep;16(9):4754-64.
REF 4 USF/c-Myc enhances, while Yin-Yang 1 suppresses, the promoter activity of CXCR4, a coreceptor for HIV-1 entry. J Immunol. 1999 May 15;162(10):5986-92.
REF 5 c-myc reverses neu-induced transformed morphology by transcriptional repression. Mol Cell Biol. 1991 Jan;11(1):354-62.
REF 6 Sp1 cooperates with c-Myc to activate transcription of the human telomerase reverse transcriptase gene (hTERT). Nucleic Acids Res. 2000 Feb 1;28(3):669-77.
REF 7 The ornithine decarboxylase gene is a transcriptional target of c-Myc. Proc Natl Acad Sci U S A. 1993 Aug 15;90(16):7804-8.
REF 8 Intracellular cholesterol transport in synchronized human skin fibroblasts. Biochemistry. 1999 Feb 23;38(8):2506-13.
REF 9 Constitutive protection of E2F recognition sequences in the human thymidine kinase promoter during cell cycle progression. J Biol Chem. 1997 Nov 28;272(48):30483-90.
REF 10 An inverted repeat motif stabilizes binding of E2F and enhances transcription of the dihydrofolate reductase gene. J Biol Chem. 1995 Apr 28;270(17):9783-91.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.