Target Regulator(s) Information (Transcription Factor)

Content Navigation (  All   None )                                      
Target General Information
The Transcription Factors (TFs) Regulating This Target
References
Target General Information  Top
Target ID T28692 Target Info
Target Name Lipoprotein lipase (LPL)
Synonyms LIPD
Target Type Successful Target
Gene Name LPL
Biochemical Class Carboxylic ester hydrolase
UniProt ID
LIPL_HUMAN
The Transcription Factors (TFs) Regulating This Target  Top
TF Name Octamer-binding protein 1 (POU2F1)
Classification Superclass Helix-turn-helix
Class Homeo domain
Family POU domain factors
Regulation Type Increase
Regulation Mechanism Several potential binding sites for transcription factors, including the recognition sequences for CCAAT/enhancer-binding protein and Octamer-binding protein 1 have been described in the 5'-flanking region of the human LPL gene. [1]
Evidence Score (E-score) 2 +
1 Electrophoretic Mobility Shift Assay, DNA Coimmunoprecipitation Assay, DNase I Footprint Analysis, Chloramphenicol Acetyltransferase Assay [3]
2 Electrophoretic Mobility Shift Assay, DNase I Footprint Analysis [1]
UniProt ID
PO2F1_HUMAN
Sequence
MNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTS
LQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQ
LLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQPIQIAQDLQQLQ
QLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQGLLQAQNLLTQLPQQSQANLLQSQ
PSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRI
KLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENLSSDS
SLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEK
EVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSLVTSSAATTLTVSP
VLPLTSAAVTNLSVTGTSDTTSNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSA
SETSTTQTTSTPLSSPLGTSQVMVTASGLQTAAAAALQGAAQLPANASLAAMAAAAGLNP
SLMAPSQFAAGGALLSLNPGTLSGALSPALMSNSTLATIQALASGGSLPITSLDATGNLV
FANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASAGNSAPVASLHATSTSAESIQ
NSLFTVASASGAASTTTTASKAQ
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Ester hydrolases [+] 1 Ester hydrolases Co-regulated By This TF +
1 Lipoprotein lipase (LPL) Successful Target Target Info [1]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 Gonadotropin-releasing hormone receptor (GNRHR) Successful Target Target Info [5]
Glycoproteins [+] 1 Glycoproteins Co-regulated By This TF +
1 von Willebrand factor (VWF) Successful Target Target Info [6]
TF Name Peroxisome proliferator-activated receptor gamma (PPAR-G)
Classification Superclass Zinc-coordinating DNA-binding domains
Class Cys4 zinc finger of nuclear receptor type
Family Thyroid hormone receptor-like factors
Subfamily Thyroid hormone receptors
Regulation Type Increase
Regulation Mechanism A sequence element was identified in the humanLPLpromoterthat mediates the functional responsiveness to fibrates and thiazolidinediones. Methylation interference and gel retardation assays demonstrated that a PPARalpha or gamma and the 9-cis retinoic acid receptor (RXR) heterodimers bind to this sequence -169 TGCCCTTTCCCCC -157. [2]
Evidence Score (E-score) 2 +
1 Electrophoretic Mobility Shift Assay [4]
2 Methylation Interference Assay, Electrophoretic Mobility Shift Assay [2]
UniProt ID
PPARG_HUMAN
Sequence
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Ester hydrolases [+] 1 Ester hydrolases Co-regulated By This TF +
1 Lipoprotein lipase (LPL) Successful Target Target Info [2]
TF Name Retinoid X receptor alpha (RXR-A)
Classification Superclass Zinc-coordinating DNA-binding domains
Class Cys4 zinc finger of nuclear receptor type
Family Thyroid hormone receptor-like factors
Subfamily Retinoid X receptors
Regulation Type Increase
Regulation Mechanism A sequence element was identified in the humanLPLpromoterthat mediates the functional responsiveness to fibrates and thiazolidinediones. Methylation interference and gel retardation assays demonstrated that a PPARalpha or gamma and the 9-cis retinoic acid receptor (RXR) heterodimers bind to this sequence -169 TGCCCTTTCCCCC -157. [2]
Evidence Score (E-score) 1 +
1 Methylation Interference Assay, Electrophoretic Mobility Shift Assay [2]
UniProt ID
RXRA_HUMAN
Sequence
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Acyltransferases [+] 1 Acyltransferases Co-regulated By This TF +
1 Carnitine O-palmitoyltransferase I (CPT1B) Successful Target Target Info [7]
Apolipoproteins [+] 4 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein A-I (APOA1) Clinical trial Target Target Info [8]
2 Apolipoprotein A-II (APOA2) Literature-reported Target Target Info [9]
3 Apolipoprotein C-III (ApoCIII) Clinical trial Target Target Info [10]
4 Apolipoprotein E (APOE) Clinical trial Target Target Info [11]
Ester hydrolases [+] 1 Ester hydrolases Co-regulated By This TF +
1 Lipoprotein lipase (LPL) Successful Target Target Info [2]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 Extracellular calcium-sensing receptor (CASR) Successful Target Target Info [12]
Glycoproteins [+] 2 Glycoproteins Co-regulated By This TF +
1 Cholesteryl ester transfer protein (CETP) Clinical trial Target Target Info [13]
2 Phospholipid transfer protein (PLTP) Literature-reported Target Target Info [14]
Kinases [+] 1 Kinases Co-regulated By This TF +
1 Epidermal growth factor receptor (EGFR) Successful Target Target Info [15]
Mitochondrial carriers [+] 1 Mitochondrial carriers Co-regulated By This TF +
1 Mitochondrial uncoupling protein 3 (UCP3) Clinical trial Target Target Info [16]
Nuclear hormone receptors [+] 4 Nuclear hormone receptors Co-regulated By This TF +
1 Hepatocyte nuclear factor 4-alpha (HNF4A) Literature-reported Target Target Info [17]
2 Retinoic acid receptor beta (RARB) Successful Target Target Info [18]
3 Retinoic acid receptor gamma (RARG) Successful Target Target Info [19]
4 Retinoic acid receptor RXR-gamma (RXRG) Successful Target Target Info [20]
TF Name CCAAT/enhancer-binding protein (CEBP) homo/heterodimer
Classification Superclass Basic Domains
Class Leucine zipper factors (bZIP)
Family C/EBP-like factors
Regulation Mechanism Several potential binding sites for transcription factors, including the recognition sequences for CCAAT/enhancer-binding protein and Octamer-binding protein 1 have been described in the 5'-flanking region of the human LPL gene. [1]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay, DNase I Footprint Analysis [1]
UniProt ID
CEBPA_HUMAN; CEBPB_HUMAN; CEBPD_HUMAN; CEBPG_HUMAN; CEBPZ_HUMAN
Sequence
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVM
PGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP
YQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPA
LGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR
DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apolipoproteins [+] 1 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein A-I (APOA1) Clinical trial Target Target Info [21]
Ester hydrolases [+] 1 Ester hydrolases Co-regulated By This TF +
1 Lipoprotein lipase (LPL) Successful Target Target Info [1]
Growth factors [+] 1 Growth factors Co-regulated By This TF +
1 Insulin-like growth factor-II (IGF2) Clinical trial Target Target Info [22]
TF Name TATA-binding factor (TBP)
Classification Superclass beta-Scaffold Factors with Minor Groove Contacts
Class TATA-binding proteins
Family TATA-binding protein
Regulation Mechanism TFIIB did not alter the DNase I footprints generated by Oct-1 on the LPL and H2B promoters. However, Oct-1 on the TATA-binding protein and TFIIB from footprinting the perfect TATA box sequence located 5' of the LPL, NF-Y binding site. [3]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay, DNA Coimmunoprecipitation Assay, DNase I Footprint Analysis, Chloramphenicol Acetyltransferase Assay [3]
UniProt ID
TBP_HUMAN
Sequence
MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQ
QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQ
LFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDL
KTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARV
VQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRI
VLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apoptosis regulators [+] 1 Apoptosis regulators Co-regulated By This TF +
1 Apoptosis regulator Bcl-2 (BCL-2) Successful Target Target Info [23]
Coagulation factors [+] 1 Coagulation factors Co-regulated By This TF +
1 Coagulation factor VIII (F8) Successful Target Target Info [24]
Ester hydrolases [+] 1 Ester hydrolases Co-regulated By This TF +
1 Lipoprotein lipase (LPL) Successful Target Target Info [3]
TF Name Octamer-binding protein 2 (POU2F2)
Classification Superclass Helix-turn-helix
Class Homeo domain
Family POU domain factors
Subfamily II
Regulation Type Increase
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay, DNA Coimmunoprecipitation Assay, DNase I Footprint Analysis, Chloramphenicol Acetyltransferase Assay [3]
UniProt ID
PO2F2_HUMAN
Sequence
MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPS
TKIKAEDPSGDSAPAAPLPPQPAQPHLPQAQLMLTGSQLAGDIQQLLQLQQLVLVPGHHL
QPPAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPRAGLPTQAVTRPTLPDPHLS
HPQPPKCLEPPSHPEEPSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTT
ISRFEALNLSFKNMCKLKPLLEKWLNDAETMSVDSSLPSPNQLSSPSLGFDGLPGRRRKK
RTSIETNVRFALEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRINPCSA
APMLPSPGKPASYSPHMVTPQGGAGTLPLSQASSSLSTTVTTLSSAVGTLHPSRTAGGGG
GGGGAAPPLNSIPSVTPPPPATTNSTNPSPQGSHSAIGLSGLNPSTGPGLWWNPAPYQP
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Ester hydrolases [+] 1 Ester hydrolases Co-regulated By This TF +
1 Lipoprotein lipase (LPL) Successful Target Target Info [3]
References  Top
REF 1 Transcriptional regulation of the human lipoprotein lipase gene in 3T3-L1 adipocytes. J Biol Chem. 1991 Oct 5;266(28):18958-63.
REF 2 PPARalpha and PPARgamma activators direct a distinct tissue-specific transcriptional response via a PPRE in the lipoprotein lipase gene. EMBO J. 1996 Oct 1;15(19):5336-48.
REF 3 Interaction of Oct-1 with TFIIB. Implications for a novel response elicited through the proximal octamer site of the lipoprotein lipase promoter. J Biol Chem. 1995 Aug 18;270(33):19613-23.
REF 4 DNA bending is induced by binding of the peroxisome proliferator-activated receptor gamma 2 heterodimer to its response element in the murine lipop... Biochem Biophys Res Commun. 1998 Mar 27;244(3):671-7.
REF 5 Functional mapping of a placenta-specific upstream promoter for human gonadotropin-releasing hormone receptor gene. Endocrinology. 2001 Apr;142(4):1506-16.
REF 6 Oct-1 is involved in the transcriptional repression of the von willebrand factor gene promoter. Blood. 1998 Aug 15;92(4):1247-58.
REF 7 Co-regulation of tissue-specific alternative human carnitine palmitoyltransferase Ibeta gene promoters by fatty acid enzyme substrate. J Biol Chem. 1998 Dec 4;273(49):32901-9.
REF 8 Bile acid-activated nuclear receptor FXR suppresses apolipoprotein A-I transcription via a negative FXR response element. J Clin Invest. 2002 Apr;109(7):961-71.
REF 9 Retinoids increase human apolipoprotein A-11 expression through activation of the retinoid X receptor but not the retinoic acid receptor. Mol Cell Biol. 1996 Jul;16(7):3350-60.
REF 10 Mode of action of peroxisome proliferators as hypolipidemic drugs. Suppression of apolipoprotein C-III. J Biol Chem. 1995 Jun 2;270(22):13470-5.
REF 11 LXRs control lipid-inducible expression of the apolipoprotein E gene in macrophages and adipocytes. Proc Natl Acad Sci U S A. 2001 Jan 16;98(2):507-12.
REF 12 Human calcium-sensing receptor gene. Vitamin D response elements in promoters P1 and P2 confer transcriptional responsiveness to 1,25-dihydroxyvitamin D. J Biol Chem. 2002 Aug 16;277(33):30337-50.
REF 13 The orphan nuclear receptor LRH-1 potentiates the sterol-mediated induction of the human CETP gene by liver X receptor. J Biol Chem. 2001 Jul 6;276(27):24767-73.
REF 14 The farnesoid X-activated receptor mediates bile acid activation of phospholipid transfer protein gene expression. J Biol Chem. 2000 Dec 15;275(50):39313-7.
REF 15 T3 receptor suppression of Sp1-dependent transcription from the epidermal growth factor receptor promoter via overlapping DNA-binding sites. J Biol Chem. 1993 Jul 25;268(21):16065-73.
REF 16 The human uncoupling protein-3 gene promoter requires MyoD and is induced by retinoic acid in muscle cells. FASEB J. 2000 Nov;14(14):2141-3.
REF 17 Regulatory mechanisms controlling human hepatocyte nuclear factor 4alpha gene expression. Mol Cell Biol. 2001 Nov;21(21):7320-30.
REF 18 Vitamin D represses retinoic acid-dependent transactivation of the retinoic acid receptor-beta2 promoter: the AF-2 domain of the vitamin D receptor is required for transrepression. Endocrinology. 1999 Jun;140(6):2898-907.
REF 19 RAR gamma 2 expression is regulated through a retinoic acid response element embedded in Sp1 sites. Mol Cell Biol. 1992 Jul;12(7):2976-85.
REF 20 Identification of thyroid hormone response elements in the human fatty acid synthase promoter. Proc Natl Acad Sci U S A. 1998 Oct 13;95(21):12260-5.
REF 21 Promoter elements and factors involved in hepatic transcription of the human ApoA-I gene positive and negative regulators bind to overlapping sites. J Biol Chem. 1991 Mar 25;266(9):5790-7.
REF 22 The liver-specific promoter of the human insulin-like growth factor II gene is activated by CCAAT/enhancer binding protein (C/EBP). Nucleic Acids Res. 1992 Jun 25;20(12):3099-104.
REF 23 Negative regulation of bcl-2 expression by p53 in hematopoietic cells. Oncogene. 2001 Jan 11;20(2):240-51.
REF 24 cis-acting elements and transcription factors involved in the promoter activity of the human factor VIII gene. J Biol Chem. 1995 May 19;270(20):11828-38.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.