Target Regulator(s) Information (Transcription Factor)

Content Navigation (  All   None )                                      
Target General Information
The Transcription Factors (TFs) Regulating This Target
References
Target General Information  Top
Target ID T83369 Target Info
Target Name Coagulation factor IX (F9)
Synonyms Plasma thromboplastin component; PTC protein; Factor IX; Christmas factor
Target Type Successful Target
Gene Name F9
Biochemical Class Peptidase
UniProt ID
FA9_HUMAN
The Transcription Factors (TFs) Regulating This Target  Top
TF Name C/EBP alpha (CEBPA) homodimer
Classification Superclass Basic Domains
Class Leucine zipper factors (bZIP)
Family C/EBP-like factors
Regulation Type Increase
Regulation Mechanism Transactivation of the factor IX promoter by the PAR proteins DBP and hepatic leukemia factor (HLF) is dependent on the binding of GABPalpha/beta to site 5, and coexpression of these two factors is required for optimal activation of this promoter. [1]
Evidence Score (E-score) 2 +
1 Electrophoretic Mobility Shift Assay [1]
2 Electrophoretic Mobility Shift Assay [3]
UniProt ID
CEBPA_HUMAN
Sequence
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVM
PGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP
YQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPA
LGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR
DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apolipoproteins [+] 3 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein A-II (APOA2) Literature-reported Target Target Info [4]
2 Apolipoprotein B-100 (APOB) Clinical trial Target Target Info [5]
3 Apolipoprotein E (APOE) Clinical trial Target Target Info [6]
Calcium-binding proteins [+] 1 Calcium-binding proteins Co-regulated By This TF +
1 Calgranulin B (S100A9) Clinical trial Target Target Info [7]
Coagulation factors [+] 1 Coagulation factors Co-regulated By This TF +
1 Coagulation factor VIII (F8) Successful Target Target Info [8]
Cytokines / Cytokine receptors [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Granulocyte colony-stimulating factor receptor (G-CSF-R) Successful Target Target Info [9]
Glycoproteins [+] 1 Glycoproteins Co-regulated By This TF +
1 Cholesteryl ester transfer protein (CETP) Clinical trial Target Target Info [10]
Integrins [+] 1 Integrins Co-regulated By This TF +
1 Integrin alpha-2 (ITGA2) Clinical trial Target Target Info [11]
Lipoprotein receptors [+] 1 Lipoprotein receptors Co-regulated By This TF +
1 Low-density lipoprotein receptor (LDL-R) Successful Target Target Info [12]
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Entamoeba Alcohol dehydrogenase 2 (Entamo ADH2) Literature-reported Target Target Info [13]
Peptidases [+] 1 Peptidases Co-regulated By This TF +
1 Coagulation factor IX (F9) Successful Target Target Info [1]
Somatotropin / Prolactins [+] 1 Somatotropin / Prolactins Co-regulated By This TF +
1 Prolactin (PRL) Discontinued Target Target Info [14]
Transferrins [+] 1 Transferrins Co-regulated By This TF +
1 Transferrin (TF) Clinical trial Target Target Info [15]
TF Name Hepatocyte nuclear factor 4-alpha (HNF-4A) homodimer
Classification Superclass Zinc-coordinating DNA-binding domains
Class Cys4 zinc finger of nuclear receptor type
Family Thyroid hormone receptor-like factors
Subfamily Hepatocyte nuclear factor 4
Regulation Type Increase
Evidence Score (E-score) 1 +
1 DNase I Footprint Analysis [2]
UniProt ID
HNF4A_HUMAN
Sequence
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKK
IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK
DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK
GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL
FGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW
PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apolipoproteins [+] 4 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein A-I (APOA1) Clinical trial Target Target Info [16]
2 Apolipoprotein A-II (APOA2) Literature-reported Target Target Info [17]
3 Apolipoprotein B-100 (APOB) Clinical trial Target Target Info [5]
4 Apolipoprotein C-III (ApoCIII) Clinical trial Target Target Info [18]
Coagulation factors [+] 1 Coagulation factors Co-regulated By This TF +
1 Coagulation factor VIII (F8) Successful Target Target Info [19]
Hormones [+] 1 Hormones Co-regulated By This TF +
1 Erythropoietin (EPO) Clinical trial Target Target Info [20]
Nuclear hormone receptors [+] 1 Nuclear hormone receptors Co-regulated By This TF +
1 Hepatocyte nuclear factor 4-alpha (HNF4A) Literature-reported Target Target Info [21]
Oxidoreductases [+] 2 Oxidoreductases Co-regulated By This TF +
1 Debrisoquine 4-hydroxylase (CYP2D6) Successful Target Target Info [22]
2 Heme oxygenase 1 (HMOX1) Clinical trial Target Target Info [23]
Peptidases [+] 1 Peptidases Co-regulated By This TF +
1 Coagulation factor IX (F9) Successful Target Target Info [2]
Serpin proteins [+] 1 Serpin proteins Co-regulated By This TF +
1 Angiotensinogen (AGT) Literature-reported Target Target Info [24]
Transferrins [+] 1 Transferrins Co-regulated By This TF +
1 Transferrin (TF) Clinical trial Target Target Info [15]
TF Name GA-binding protein (GABP) heterotetramer
Classification Superclass Helix-turn-helix
Class Tryptophan clusters
Family Ets-type
Regulation Mechanism Transactivation of the factor IX promoter by the PAR proteins DBP and hepatic leukemia factor (HLF) is dependent on the binding of GABPalpha/beta to site 5, and coexpression of these two factors is required for optimal activation of this promoter. [1]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay [1]
UniProt ID
GABPA_HUMAN/GABP1_HUMAN/GABP2_HUMAN
Sequence
MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQ
CSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTV
EVVIDPDAHHAESEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERL
GIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEIL
WSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVQSATPTTIKVINSSAKAAKVQRAP
RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKW
GQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTE
CEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Cytokines / Cytokine receptors [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interleukin 2 receptor beta (IL2RB) Clinical trial Target Target Info [25]
Integrins [+] 1 Integrins Co-regulated By This TF +
1 Integrin beta-2 (ITGB2) Clinical trial Target Target Info [26]
Peptidases [+] 1 Peptidases Co-regulated By This TF +
1 Coagulation factor IX (F9) Successful Target Target Info [1]
Zinc-fingers [+] 1 Zinc-fingers Co-regulated By This TF +
1 Utrophin (UTRN) Clinical trial Target Target Info [27]
References  Top
REF 1 Binding of the Ets factor GA-binding protein to an upstream site in the factor IX promoter is a critical event in transactivation. Mol Cell Biol. 1996 May;16(5):1929-35.
REF 2 Disruption of a C/EBP binding site in the factor IX promoter is associated with haemophilia B. Nature. 1990 May 31;345(6274):444-6.
REF 3 Haemophilia B Leyden: the effect of mutations at position +13 on the liver-specific transcription of the factor IX gene. Blood Coagul Fibrinolysis. 1994 Jun;5(3):341-8.
REF 4 Regulation of the human ApoA-II gene by the synergistic action of factors binding to the proximal and distal regulatory elements. J Biol Chem. 1991 Dec 25;266(36):24460-70.
REF 5 Identification and characterization of a 315-base pair enhancer, located more than 55 kilobases 5' of the apolipoprotein B gene, that confers expression in the intestine. J Biol Chem. 2000 Aug 25;275(34):26637-48.
REF 6 Structure of the hepatic control region of the human apolipoprotein E/C-I gene locus. J Biol Chem. 1995 Sep 22;270(38):22577-85.
REF 7 Transcriptional regulation by C/EBP alpha and -beta in the expression of the gene for the MRP14 myeloid calcium binding protein. Cell Struct Funct. 1998 Jun;23(3):109-18.
REF 8 Role of the liver-enriched transcription factor hepatocyte nuclear factor 1 in transcriptional regulation of the factor V111 gene. Mol Cell Biol. 1996 May;16(5):1936-45.
REF 9 PU.1 (Spi-1) and C/EBP alpha regulate the granulocyte colony-stimulating factor receptor promoter in myeloid cells. Blood. 1996 Aug 15;88(4):1234-47.
REF 10 The CCAAT/enhancer-binding protein trans-activates the human cholesteryl ester transfer protein gene promoter. J Biol Chem. 1992 Nov 5;267(31):22336-9.
REF 11 The alpha2 and alpha5 integrin genes: identification of transcription factors that regulate promoter activity in epidermal keratinocytes. FEBS Lett. 2000 Jun 2;474(2-3):201-7.
REF 12 Identification of a novel sterol-independent regulatory element in the human low density lipoprotein receptor promoter. J Biol Chem. 2000 Feb 18;275(7):5214-21.
REF 13 The role of CCAAT/enhancer-binding protein in the differential transcriptional regulation of a family of human liver alcohol dehydrogenase genes. J Biol Chem. 1991 Jun 25;266(18):11594-603.
REF 14 CCAAT/enhancer-binding proteins are mediators in the protein kinase A-dependent activation of the decidual prolactin promoter. J Biol Chem. 1999 Aug 27;274(35):24808-18.
REF 15 A different combination of transcription factors modulates the expression of the human transferrin promoter in liver and Sertoli cells. J Biol Chem. 1993 Nov 5;268(31):23399-408.
REF 16 Modulation of transcriptional activation and coactivator interaction by a splicing variation in the F domain of nuclear receptor hepatocyte nuclear factor 4alpha1. Mol Cell Biol. 1999 Oct;19(10):6509-22.
REF 17 Transcriptional regulation of human apolipoprotein genes ApoB, ApoCIII, and ApoAII by members of the steroid hormone receptor superfamily HNF-4, AR... J Biol Chem. 1992 Aug 5;267(22):15849-60.
REF 18 Mitogen-activated protein kinase regulates transcription of the ApoCIII gene. Involvement of the orphan nuclear receptor HNF4. J Biol Chem. 1999 Nov 12;274(46):33050-6.
REF 19 cis-acting elements and transcription factors involved in the promoter activity of the human factor VIII gene. J Biol Chem. 1995 May 19;270(20):11828-38.
REF 20 The orphan receptor hepatic nuclear factor 4 functions as a transcriptional activator for tissue-specific and hypoxia-specific erythropoietin gene expression and is antagonized by EAR3/COUP-TF1. Mol Cell Biol. 1995 Apr;15(4):2135-44.
REF 21 Regulatory mechanisms controlling human hepatocyte nuclear factor 4alpha gene expression. Mol Cell Biol. 2001 Nov;21(21):7320-30.
REF 22 Characterization of the human cytochrome P4502D6 promoter. A potential role for antagonistic interactions between members of the nuclear receptor family. J Biol Chem. 1996 Oct 11;271(41):25269-76.
REF 23 Co-operation of the transcription factor hepatocyte nuclear factor-4 with Sp1 or Sp3 leads to transcriptional activation of the human haem oxygenase-1 gene promoter in a hepatoma cell line. Biochem J. 2002 Nov 1;367(Pt 3):641-52.
REF 24 Regulated expression of human angiotensinogen gene by hepatocyte nuclear factor 4 and chicken ovalbumin upstream promoter-transcription factor. J Biol Chem. 1999 Dec 3;274(49):34605-12.
REF 25 Characterization of the human interleukin-2 receptor beta-chain gene promoter: regulation of promoter activity by ets gene products. Mol Cell Biol. 1993 Oct;13(10):6201-10.
REF 26 The human beta 2 integrin CD18 promoter consists of two inverted Ets cis elements. Mol Cell Biol. 1994 Apr;14(4):2604-15.
REF 27 Induction of utrophin gene expression by heregulin in skeletal muscle cells: role of the N-box motif and GA binding protein. Proc Natl Acad Sci U S A. 1999 Mar 16;96(6):3223-7.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.