Target Regulator(s) Information (Transcription Factor)

Content Navigation (  All   None )                                      
Target General Information
The Transcription Factors (TFs) Regulating This Target
References
Target General Information  Top
Target ID T52389 Target Info
Target Name Quinone reductase 1 (NQO1)
Synonyms Qui reductase 1; QR1; Phylloquinone reductase; Phylloqui reductase; NMOR1; NAD(P)H:quinone oxidoreductase 1; NAD(P)H dehydrogenase [quinone] 1; Menadione reductase; DTD; DT-diaphorase 1; DT-diaphorase; DIA4; Azoreductase
Target Type Clinical trial Target
Gene Name NQO1
Biochemical Class NADH/NADPH oxidoreductase
UniProt ID
NQO1_HUMAN
The Transcription Factors (TFs) Regulating This Target  Top
TF Name Jun-D/c-Fos (AP-1) heterodimer
Classification Superclass Basic Domains
Class Leucine zipper factors (bZIP)
Family AP-1(-like) components
Regulation Type Decrease
Evidence Score (E-score) 2 +
1 Electrophoretic Mobility Shift Assay [1]
2 Electrophoretic Mobility Shift Assay [4]
UniProt ID
JUND_HUMAN/FOS_HUMAN
Sequence
METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAA
ALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTS
SQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPG
ELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALK
DEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV
KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Quinone reductase 1 (NQO1) Clinical trial Target Target Info [1]
Somatotropin / Prolactins [+] 1 Somatotropin / Prolactins Co-regulated By This TF +
1 Prolactin (PRL) Discontinued Target Target Info [7]
TF Name Estrogen receptor beta (ESR2) homodimer
Classification Superclass Zinc-coordinating DNA-binding domains
Class Cys4 zinc finger of nuclear receptor type
Family Steroid hormone receptors
Subfamily Estrogen receptor
Regulation Type Increase
Regulation Mechanism NQOgene regulation by the ESR is mediated by the EpRE-containing region of the humanNQOgene, and theERis one of the complex of proteins that binds to the EpRE. [2]
Evidence Score (E-score) 2 +
1 Electrophoretic Mobility Shift Assay [2]
2 Electrophoretic Mobility Shift Assay [5]
UniProt ID
ESR2_HUMAN
Sequence
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS
NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH
NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH
CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL
VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA
DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK
CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Quinone reductase 1 (NQO1) Clinical trial Target Target Info [2]
TF Name Activator protein 2 (AP-2) homodimer
Classification Superclass Basic Domains
Class bHSH
Family AP-2
Regulation Type Increase
Regulation Mechanism AP-2, at nucleotide position -157 of the human NQO1 gene promotor that regulates basal and cAMP-induced transcription of the NQO1 gene. [3]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay [3]
UniProt ID
AP2A_HUMAN
Sequence
MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPP
PYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSG
LDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPV
SLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSP
PECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHL
ARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLG
NSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNS
HTDNNAKSSDKEEKHRK
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apoptosis regulators [+] 1 Apoptosis regulators Co-regulated By This TF +
1 Apoptosis regulator Bcl-2 (BCL-2) Successful Target Target Info [8]
Cytokines / Cytokine receptors [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interferon-gamma (IFNG) Successful Target Target Info [9]
Ester hydrolases [+] 1 Ester hydrolases Co-regulated By This TF +
1 Acetylcholinesterase (AChE) Successful Target Target Info [10]
Growth factors [+] 1 Growth factors Co-regulated By This TF +
1 Vascular endothelial growth factor A (VEGFA) Successful Target Target Info [11]
Kinases [+] 1 Kinases Co-regulated By This TF +
1 Serine/threonine-protein kinase pim-1 (PIM1) Clinical trial Target Target Info [12]
Oxidoreductases [+] 3 Oxidoreductases Co-regulated By This TF +
1 Dopamine beta hydroxylase (DBH) Clinical trial Target Target Info [13]
2 Estradiol 17 beta-dehydrogenase 1 (17-beta-HSD1) Clinical trial Target Target Info [14]
3 Quinone reductase 1 (NQO1) Clinical trial Target Target Info [3]
Peptidases [+] 2 Peptidases Co-regulated By This TF +
1 Matrix metalloproteinase-2 (MMP-2) Successful Target Target Info [15]
2 Neutral endopeptidase (MME) Clinical trial Target Target Info [16]
Pro-neuropeptides [+] 1 Pro-neuropeptides Co-regulated By This TF +
1 Neuropeptide Y (NPY) Literature-reported Target Target Info [17]
TF Name c-Jun/c-Fos (AP-1) heterodimer
Classification Superclass Basic Domains
Class Leucine zipper factors (bZIP)
Family AP-1(-like) components
Regulation Type Decrease
Regulation Mechanism Human antioxidant-response element (hARE) containing two copies of the AP1/AP1-like elements arranged as inverse repeat is known to mediate basal and beta-naphthoflavone-induced transcription of the type 1 NAD(P)H:quinone oxidoreductase (NQO1) gene. [4]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay [4]
UniProt ID
JUN_HUMAN/FOS_HUMAN
Sequence
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Acyltransferases [+] 1 Acyltransferases Co-regulated By This TF +
1 Glutathione S-transferase P (GSTP1) Clinical trial Target Target Info [18]
Cytokines / Cytokine receptors [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interferon-gamma (IFNG) Successful Target Target Info [19]
Endothelins/sarafotoxins [+] 1 Endothelins/sarafotoxins Co-regulated By This TF +
1 Endothelin-1 (EDN1) Literature-reported Target Target Info [20]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 Gonadotropin-releasing hormone receptor (GNRHR) Successful Target Target Info [21]
Glucagons [+] 1 Glucagons Co-regulated By This TF +
1 Vasoactive intestinal polypeptide (VIP) Literature-reported Target Target Info [22]
Hormones [+] 1 Hormones Co-regulated By This TF +
1 Corticoliberin (CRH) Literature-reported Target Target Info [23]
Integrins [+] 1 Integrins Co-regulated By This TF +
1 Integrin alpha-2 (ITGA2) Clinical trial Target Target Info [24]
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Quinone reductase 1 (NQO1) Clinical trial Target Target Info [4]
Peptidases [+] 1 Peptidases Co-regulated By This TF +
1 Urokinase-type plasminogen activator (PLAU) Successful Target Target Info [25]
Somatotropin / Prolactins [+] 1 Somatotropin / Prolactins Co-regulated By This TF +
1 Prolactin (PRL) Discontinued Target Target Info [26]
Transcription factors [+] 2 Transcription factors Co-regulated By This TF +
1 Cellular tumor antigen p53 (TP53) Clinical trial Target Target Info [27]
2 Transcription factor AP-1 (JUN) Discontinued Target Target Info [28]
TF Name Estrogen receptor alpha (ESR1) homodimer
Classification Superclass Zinc-coordinating DNA-binding domains
Class Cys4 zinc finger of nuclear receptor type
Family Steroid hormone receptors
Subfamily Estrogen receptor
Regulation Type Increase
Regulation Mechanism The stimulation of NQO1 transcriptional activity requires the 31-base pair electrophile-responsive region from the human NQO1 gene promoter and a functional ESR. [5]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay [5]
UniProt ID
ESR1_HUMAN
Sequence
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Nuclear hormone receptors [+] 1 Nuclear hormone receptors Co-regulated By This TF +
1 Progesterone receptor (PGR) Successful Target Target Info [29]
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Quinone reductase 1 (NQO1) Clinical trial Target Target Info [5]
Peptidases [+] 1 Peptidases Co-regulated By This TF +
1 Cathepsin D (CTSD) Clinical trial Target Target Info [30]
TF Name Nuclear respiratory factor 1 (NRF1) homodimer
Classification Superclass Basic Domains
Class Leucine zipper factors (bZIP)
Regulation Type Increase
Regulation Mechanism The nuclear transcription factorNRF2andNRF1 bind to the ARE and positively regulate expression and induction of theNQO1and GST Ya genes. [6]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay [6]
UniProt ID
NRF1_HUMAN
Sequence
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILN
STAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLD
EYTTRVGQQAIVLCISPSKPNPVFKVFGAAPLENVVRKYKSMILEDLESALAEHAPAPQE
VNSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPW
ANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQTQATATHSIAHL
VPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNW
ATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLAE
ATLQGGGQIVLSGETAAAVGALTGVQDANGLVQIPVSMYQTVVTSLAQGNGPVQVAMAPV
TTRISDSAVTMDGQAVEVVTLEQ
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 C-X-C chemokine receptor type 4 (CXCR4) Successful Target Target Info [31]
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Quinone reductase 1 (NQO1) Clinical trial Target Target Info [6]
TF Name MafG/NFE2L2 (Maf-Nrf2) heterodimer
Classification Superclass Basic Domains
Class Leucine zipper factors (bZIP)
Family AP-1(-like) components
Regulation Type Decrease
Regulation Mechanism Maf-Mafhomodimers and possiblyMaf-Nrf2heterodimers play a role in negative regulation of ARE-mediated transcription and antioxidant induction ofNQO1and other detoxifying enzyme genes. [6]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay [6]
UniProt ID
MAFG_HUMAN/NF2L2_HUMAN
Sequence
MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLK
NRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFART
VARSPVAPARGPLAAGLGPLVPGKVAATSVITIVKSKTDARS
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Quinone reductase 1 (NQO1) Clinical trial Target Target Info [6]
TF Name MafG transcription factor (MAF) homodimer
Classification Superclass Basic?Domains
Class Leucine?zipper?factors?(bZIP)
Regulation Type Decrease
Regulation Mechanism Maf-Mafhomodimers and possiblyMaf-Nrf2heterodimers play a role in negative regulation of ARE-mediated transcription and antioxidant induction ofNQO1and other detoxifying enzyme genes. [6]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay [6]
UniProt ID
MAFG_HUMAN
Sequence
MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLK
NRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFART
VARSPVAPARGPLAAGLGPLVPGKVAATSVITIVKSKTDARS
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Quinone reductase 1 (NQO1) Clinical trial Target Target Info [6]
References  Top
REF 1 ARE- and TRE-mediated regulation of gene expression. Response to xenobiotics and antioxidants. J Biol Chem. 1995 Mar 24;270(12):6894-900.
REF 2 Identification and characterization of a novel factor that regulates quinone reductase gene transcriptional activity. J Biol Chem. 2000 Nov 3;275(44):34306-13.
REF 3 AP-2-mediated regulation of human NAD(P)H: quinone oxidoreductase 1 (NQO1) gene expression. Biochem Pharmacol. 1996 Mar 22;51(6):771-8.
REF 4 Human antioxidant-response-element-mediated regulation of type 1 NAD(P)H:quinone oxidoreductase gene expression. Effect of sulfhydryl modifying age... Eur J Biochem. 1994 Nov 15;226(1):31-9.
REF 5 Transcriptional regulation of the human quinone reductase gene by antiestrogen-liganded estrogen receptor-alpha and estrogen receptor-beta. J Biol Chem. 1998 Sep 25;273(39):25443-9.
REF 6 Small maf (MafG and MafK) proteins negatively regulate antioxidant response element-mediated expression and antioxidant induction of the NAD(P)H:Quinone oxidoreductase1 gene. J Biol Chem. 2000 Dec 22;275(51):40134-41.
REF 7 Transcription factor AP1 is involved in basal and okadaic acid-stimulated activity of the human PRL promoter. Mol Endocrinol. 1998 Aug;12(8):1215-27.
REF 8 The retinoblastoma protein binds the promoter of the survival gene bcl-2 and regulates its transcription in epithelial cells through transcription factor AP-2. Mol Cell Biol. 2002 Nov;22(22):7877-88.
REF 9 The nuclear factor YY1 suppresses the human gamma interferon promoter through two mechanisms: inhibition of AP1 binding and activation of a silence... Mol Cell Biol. 1996 Sep;16(9):4744-53.
REF 10 Transcription factor repression and activation of the human acetylcholinesterase gene. J Biol Chem. 1995 Oct 6;270(40):23511-9.
REF 11 Transforming growth factor-alpha-induced transcriptional activation of the vascular permeability factor (VPF/VEGF) gene requires AP-2-dependent DNA binding and transactivation. EMBO J. 1997 Feb 17;16(4):750-9.
REF 12 The human Pim-1 gene is selectively transcribed in different hemato-lymphoid cell lines in spite of a G + C-rich housekeeping promoter. Mol Cell Biol. 1990 Apr;10(4):1680-8.
REF 13 Noradrenergic-specific transcription of the dopamine beta-hydroxylase gene requires synergy of multiple cis-acting elements including at least two Phox2a-binding sites. J Neurosci. 1998 Oct 15;18(20):8247-60.
REF 14 The proximal promoter region of the gene encoding human 17beta-hydroxysteroid dehydrogenase type 1 contains GATA, AP-2, and Sp1 response elements: analysis of promoter function in choriocarcinoma cells. Endocrinology. 1997 Aug;138(8):3417-25.
REF 15 Repression of a matrix metalloprotease gene by E1A correlates with its ability to bind to cell type-specific transcription factor AP-2. Proc Natl Acad Sci U S A. 1996 Apr 2;93(7):3088-93.
REF 16 Cloning and functional characterization of the 5' flanking region of the human mitochondrial malic enzyme gene. Regulatory role of Sp1 and AP-2. Eur J Biochem. 2001 May;268(10):3017-27.
REF 17 Transcriptional regulation of the human neuropeptide Y gene by nerve growth factor. J Biol Chem. 1994 Jun 3;269(22):15460-8.
REF 18 Involvement of Jun and Fos proteins in regulating transcriptional activation of the human pi class glutathione S-transferase gene in multidrug-resi... J Biol Chem. 1994 Jun 10;269(23):16397-402.
REF 19 Negative transcriptional regulation of the interferon-gamma promoter by glucocorticoids and dominant negative mutants of c-Jun. J Biol Chem. 1995 May 26;270(21):12548-56.
REF 20 Molecular regulation of the endothelin-1 gene by hypoxia. Contributions of hypoxia-inducible factor-1, activator protein-1, GATA-2, AND p300/CBP. J Biol Chem. 2001 Apr 20;276(16):12645-53.
REF 21 Functional mapping of a placenta-specific upstream promoter for human gonadotropin-releasing hormone receptor gene. Endocrinology. 2001 Apr;142(4):1506-16.
REF 22 Cyclic AMP- and phorbol ester-induced transcriptional activation are mediated by the same enhancer element in the human vasoactive intestinal peptide gene. J Biol Chem. 1991 Feb 25;266(6):3882-7.
REF 23 Composite glucocorticoid regulation at a functionally defined negative glucocorticoid response element of the human corticotropin-releasing hormone gene. Mol Endocrinol. 1999 Oct;13(10):1629-44.
REF 24 The Megakaryocyte/Platelet-specific enhancer of the alpha2beta1 integrin gene: two tandem AP1 sites and the mitogen-activated protein kinase signal... Blood. 1999 Mar 1;93(5):1600-11.
REF 25 Role of distinct mitogen-activated protein kinase pathways and cooperation between Ets-2, ATF-2, and Jun family members in human urokinase-type plasminogen activator gene induction by interleukin-1 and tetradecanoyl phorbol acetate. Mol Cell Biol. 1999 Sep;19(9):6240-52.
REF 26 Thyroid hormone inhibits the human prolactin gene promoter by interfering with activating protein-1 and estrogen stimulations. Mol Endocrinol. 1997 Jun;11(7):986-96.
REF 27 Expression of human p53 requires synergistic activation of transcription from the p53 promoter by AP-1, NF-kappaB and Myc/Max. Oncogene. 1999 Apr 29;18(17):2728-38.
REF 28 The jun proto-oncogene is positively autoregulated by its product, Jun/AP-1. Cell. 1988 Dec 2;55(5):875-85.
REF 29 Sp1 binding sites and an estrogen response element half-site are involved in regulation of the human progesterone receptor A promoter. Mol Endocrinol. 2000 Jul;14(7):972-85.
REF 30 Estrogen receptor-Sp1 complexes mediate estrogen-induced cathepsin D gene expression in MCF-7 human breast cancer cells. J Biol Chem. 1994 Jun 3;269(22):15912-7.
REF 31 Genomic organization and functional characterization of the chemokine receptor CXCR4, a major entry co-receptor for human immunodeficiency virus type 1. J Biol Chem. 1998 Feb 20;273(8):4754-60.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.