Target Regulator(s) Information (Transcription Factor)

Content Navigation (  All   None )                                      
Target General Information
The Transcription Factors (TFs) Regulating This Target
References
Target General Information  Top
Target ID T42000 Target Info
Target Name Interleukin-1 beta (IL1B)
Synonyms IL1F2; IL-1beta; IL-1 beta; Catabolin
Target Type Successful Target
Gene Name IL1B
Biochemical Class Cytokine: interleukin
UniProt ID
IL1B_HUMAN
The Transcription Factors (TFs) Regulating This Target  Top
TF Name PU.1 proto-oncogene (SPI1)
Classification Superclass Helix-turn-helix
Class Tryptophan clusters
Family Ets-type
Regulation Type Increase
Regulation Mechanism A sequence located between positions -50 and -39 of the IL1B promoter binds the tissue-restricted Ets domain transcription factor Spi-1/PU.1 (Spi-1). [1]
Evidence Score (E-score) 2 +
1 Electrophoretic Mobility Shift Assay [1]
2 Electrophoretic Mobility Shift Assay [4]
UniProt ID
SPI1_HUMAN
Sequence
MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHS
EFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQ
YPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLL
RSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGE
VKKVKKKLTYQFSGEVLGRGGLAERRHPPH
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Cytokines / Cytokine receptors [+] 4 Cytokines / Cytokine receptors Co-regulated By This TF +
1 CD40L receptor (CD40) Clinical trial Target Target Info [9]
2 Granulocyte colony-stimulating factor receptor (G-CSF-R) Successful Target Target Info [10]
3 Interleukin-1 beta (IL1B) Successful Target Target Info [1]
4 Interleukin-12 beta (IL12B) Successful Target Target Info [11]
Integrins [+] 1 Integrins Co-regulated By This TF +
1 Integrin beta-2 (ITGB2) Clinical trial Target Target Info [12]
TF Name cAMP-responsive element-binding (CREB) homodimer
Classification Superclass Basic Domains
Class Leucine zipper factors (bZIP)
Regulation Type Decrease
Regulation Mechanism A site located between -2782 and -2729 of the IL1B gene functions as a strong LPS-responsive enhancer independent of the previously identified enhancer located between -2896 and -2846. The new enhancer is not induced by dbcAMP alone but is superinduced by costimulation with LPS-dbcAMP. This pattern of induction depends upon the nature of the sequence, a composite NF-IL6-cAMP response element (CRE) binding site. [2]
Evidence Score (E-score) 2 +
1 Chromatin Immunoprecipitation Assay [8]
2 Electrophoretic Mobility Shift Assay [2]
UniProt ID
CREB1_HUMAN
Sequence
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apoptosis regulators [+] 1 Apoptosis regulators Co-regulated By This TF +
1 Apoptosis regulator Bcl-2 (BCL-2) Successful Target Target Info [13]
Cytokines / Cytokine receptors [+] 3 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interferon-gamma (IFNG) Successful Target Target Info [14]
2 Interleukin 5 receptor alpha (IL5RA) Successful Target Target Info [15]
3 Interleukin-1 beta (IL1B) Successful Target Target Info [2]
Fibronectin proteins [+] 1 Fibronectin proteins Co-regulated By This TF +
1 Fibronectin (FN1) Clinical trial Target Target Info [16]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 Gonadotropin-releasing hormone receptor (GNRHR) Successful Target Target Info [17]
Glucagons [+] 1 Glucagons Co-regulated By This TF +
1 Vasoactive intestinal polypeptide (VIP) Literature-reported Target Target Info [18]
Hormones [+] 2 Hormones Co-regulated By This TF +
1 Erythropoietin (EPO) Clinical trial Target Target Info [19]
2 Parathyroid hormone (PTH) Successful Target Target Info [20]
Immunoglobulins [+] 1 Immunoglobulins Co-regulated By This TF +
1 T-cell surface glycoprotein CD4 (CD4) Successful Target Target Info [21]
Lipoprotein receptors [+] 1 Lipoprotein receptors Co-regulated By This TF +
1 Low-density lipoprotein receptor (LDL-R) Successful Target Target Info [22]
Oxidoreductases [+] 2 Oxidoreductases Co-regulated By This TF +
1 Cholesterol desmolase (CYP11A1) Successful Target Target Info [23]
2 Dopamine beta hydroxylase (DBH) Clinical trial Target Target Info [24]
Peptidases [+] 1 Peptidases Co-regulated By This TF +
1 Tissue-type plasminogen activator (PLAT) Successful Target Target Info [25]
Transcription factors [+] 1 Transcription factors Co-regulated By This TF +
1 Early growth response protein 1 (EGR-1) Clinical trial Target Target Info [26]
Transferrins [+] 1 Transferrins Co-regulated By This TF +
1 Transferrin (TF) Clinical trial Target Target Info [27]
TF Name NF-IL6/CREB (CEBPB/CREB) heterodimer
Classification Superclass Basic Domains
Class Leucine zipper factors (bZIP)
Regulation Type Increase/Decrease
Regulation Mechanism Electromobility shift assays demonstrate transcription factor binding at multiple IL1B promoter elements [nuclear factor (NF)-IL6/CREB, NFB1, NFkappaB, and NF-IL6], consistent with the activation of an upstream signaling pathway. [3]
Evidence Score (E-score) 2 +
1 Electrophoretic Mobility Shift Assay [3]
2 Electrophoretic Mobility Shift Assay [2]
UniProt ID
CEBPB_HUMAN/CREB1_HUMAN
Sequence
MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPA
GELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSD
LFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFE
PADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPAD
AKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQ
HKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Cytokines / Cytokine receptors [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interleukin-1 beta (IL1B) Successful Target Target Info [3]
TF Name C/EBP beta (CEBPB) homodimer
Classification Superclass Basic Domains
Class Leucine zipper factors (bZIP)
Family C/EBP-like factors
Regulation Type Increase
Regulation Mechanism The Tax-induced transcriptional activation requires two transcription factor binding motifs within the IL1B promoter; one is a binding site for nuclear factor (NF)-IL6 (CCAAT/enhancer binding protein beta, C/EBP beta), which belongs to the basic region-leucine zipper (bZIP) family. [4]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay [4]
UniProt ID
CEBPB_HUMAN
Sequence
MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPA
GELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSD
LFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFE
PADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPAD
AKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQ
HKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apolipoproteins [+] 1 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein B-100 (APOB) Clinical trial Target Target Info [28]
Calcium-binding proteins [+] 1 Calcium-binding proteins Co-regulated By This TF +
1 Calgranulin B (S100A9) Clinical trial Target Target Info [29]
Coagulation factors [+] 1 Coagulation factors Co-regulated By This TF +
1 Coagulation factor VIII (F8) Successful Target Target Info [30]
Cytokines / Cytokine receptors [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interleukin-1 beta (IL1B) Successful Target Target Info [4]
Immunoglobulins [+] 1 Immunoglobulins Co-regulated By This TF +
1 Intercellular adhesion molecule ICAM-1 (ICAM1) Successful Target Target Info [31]
Integrins [+] 1 Integrins Co-regulated By This TF +
1 Integrin alpha-2 (ITGA2) Clinical trial Target Target Info [32]
Isomerases [+] 1 Isomerases Co-regulated By This TF +
1 Leishmania DNA topoisomerase I (Leishm TOP1) Clinical trial Target Target Info [33]
Lipoprotein receptors [+] 1 Lipoprotein receptors Co-regulated By This TF +
1 Low-density lipoprotein receptor (LDL-R) Successful Target Target Info [22]
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Aromatase (CYP19A1) Successful Target Target Info [34]
Pentraxins [+] 1 Pentraxins Co-regulated By This TF +
1 CRP messenger RNA (CRP mRNA) Clinical trial Target Target Info [35]
Somatotropin / Prolactins [+] 1 Somatotropin / Prolactins Co-regulated By This TF +
1 Prolactin (PRL) Discontinued Target Target Info [36]
TF Name NF-kappa-B c-Rel-c-Rel (NFKB) homodimer
Classification Superclass beta-Scaffold Factors with Minor Groove Contacts
Class RHR (Rel homology region)
Family Rel/ankyrin
Regulation Type Increase
Regulation Mechanism The -300 region of the IL1B promoter contains a functionalNFKB binding site composed of the decamer sequence 5'-GGGAAAATCC-3'. [5]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay [5]
UniProt ID
REL_HUMAN
Sequence
MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGK
VRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAII
TRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQV
AIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLF
QKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYF
KKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTP
RSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSA
DLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMS
SSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGI
GSMQNEQLSDSFPYEFFQV
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Cytokines / Cytokine receptors [+] 4 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interferon-gamma (IFNG) Successful Target Target Info [37]
2 Interleukin 2 receptor alpha (IL2RA) Successful Target Target Info [38]
3 Interleukin-1 beta (IL1B) Successful Target Target Info [5]
4 Interleukin-12 beta (IL12B) Successful Target Target Info [11]
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Arachidonate 12-lipoxygenase (12-LOX) Literature-reported Target Target Info [39]
TF Name NF-kappa-B p50-p50 (NFKB) homodimer
Classification Superclass beta-Scaffold Factors with Minor Groove Contacts
Class RHR (Rel homology region)
Family Rel/ankyrin
Regulation Type Increase
Regulation Mechanism The -300 region of the IL1B promoter contains a functionalNFKB binding site composed of the decamer sequence 5'-GGGAAAATCC-3'. [5]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay [5]
UniProt ID
NFKB1_HUMAN
Sequence
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE
VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT
SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ
EGPLEGKI
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apolipoproteins [+] 1 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein C-III (ApoCIII) Clinical trial Target Target Info [40]
Apoptosis regulators [+] 1 Apoptosis regulators Co-regulated By This TF +
1 Apoptosis regulator Bcl-2 (BCL-2) Successful Target Target Info [41]
CD antigens [+] 1 CD antigens Co-regulated By This TF +
1 Vascular cell adhesion protein 1 (VCAM1) Literature-reported Target Target Info [42]
Coagulation factors [+] 1 Coagulation factors Co-regulated By This TF +
1 Coagulation factor VIII (F8) Successful Target Target Info [30]
Cytokines / Cytokine receptors [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interleukin-1 beta (IL1B) Successful Target Target Info [5]
2 Interleukin-12 beta (IL12B) Successful Target Target Info [43]
Immunoglobulins [+] 1 Immunoglobulins Co-regulated By This TF +
1 Intercellular adhesion molecule ICAM-1 (ICAM1) Successful Target Target Info [44]
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Arachidonate 12-lipoxygenase (12-LOX) Literature-reported Target Target Info [39]
Transcription factors [+] 1 Transcription factors Co-regulated By This TF +
1 Cellular tumor antigen p53 (TP53) Clinical trial Target Target Info [45]
TF Name NF-kappa-B p65-p65 (NFKB) homodimer
Classification Superclass beta-Scaffold Factors with Minor Groove Contacts
Class RHR (Rel homology region)
Family Rel/ankyrin
Regulation Type Increase
Regulation Mechanism The -300 region of the IL1B promoter contains a functionalNFKB binding site composed of the decamer sequence 5'-GGGAAAATCC-3'. [5]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay [5]
UniProt ID
TF65_HUMAN
Sequence
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Apolipoproteins [+] 1 Apolipoproteins Co-regulated By This TF +
1 Apolipoprotein C-III (ApoCIII) Clinical trial Target Target Info [40]
Cytokines / Cytokine receptors [+] 3 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interleukin-1 beta (IL1B) Successful Target Target Info [5]
2 Interleukin-12 beta (IL12B) Successful Target Target Info [43]
3 Interleukin-4 (IL4) Clinical trial Target Target Info [46]
Immunoglobulins [+] 1 Immunoglobulins Co-regulated By This TF +
1 Intercellular adhesion molecule ICAM-1 (ICAM1) Successful Target Target Info [44]
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 Arachidonate 12-lipoxygenase (12-LOX) Literature-reported Target Target Info [39]
Transcription factors [+] 2 Transcription factors Co-regulated By This TF +
1 Cellular tumor antigen p53 (TP53) Clinical trial Target Target Info [45]
2 Interferon regulatory factor 1 (IRF1) Literature-reported Target Target Info [47]
TF Name NF-kappa-B p65-p50 (NFKB) heterodimer
Classification Superclass beta-Scaffold Factors with Minor Groove Contacts
Class RHR (Rel homology region)
Family Rel/ankyrin
Regulation Type Increase
Regulation Mechanism NFKB regulates a nonconsensus CRE site in addition to the consensus binding site at -296/-286 bp and suggest that NFKB may play multiple roles in the induction of IL1B transcription. [6]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay [6]
UniProt ID
TF65_HUMAN/NFKB1_HUMAN
Sequence
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
CD antigens [+] 1 CD antigens Co-regulated By This TF +
1 Vascular cell adhesion protein 1 (VCAM1) Literature-reported Target Target Info [42]
Cytokines / Cytokine receptors [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interleukin-1 beta (IL1B) Successful Target Target Info [6]
Immunoglobulins [+] 1 Immunoglobulins Co-regulated By This TF +
1 Intercellular adhesion molecule ICAM-1 (ICAM1) Successful Target Target Info [48]
Kinases [+] 1 Kinases Co-regulated By This TF +
1 Casein kinase II alpha (CSNK2A1) Clinical trial Target Target Info [49]
Peptidases [+] 1 Peptidases Co-regulated By This TF +
1 Matrix metalloproteinase-9 (MMP-9) Clinical trial Target Target Info [50]
Transcription factors [+] 1 Transcription factors Co-regulated By This TF +
1 Interferon regulatory factor 1 (IRF1) Literature-reported Target Target Info [47]
TF Name Heat shock factor protein 1 (HSF1)
Classification Superclass Helix-turn-helix
Class Heat shock factors
Family Heat shock factor
Regulation Type Decrease
Regulation Mechanism Both exposure to elevated temperatures andheat-independentHSF1 expression repressed the transcription of the IL1B, and repression was strictly dependent on an intact consensusheatshock element in the IL1Bpromoterto whichHSF1 bound. [7]
Evidence Score (E-score) 1 +
1 Electrophoretic Mobility Shift Assay [7]
UniProt ID
HSF1_HUMAN
Sequence
MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKY
FKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT
SVSTLKSEDIKIRQDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHA
QQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSMPKYSRQFSLEHVHGSGPY
SAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEE
PPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGR
PPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSP
SVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGS
VDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Cytokines / Cytokine receptors [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF +
1 Interleukin-1 beta (IL1B) Successful Target Target Info [7]
References  Top
REF 1 Monocyte expression of the human prointerleukin 1 beta gene (IL1B) is dependent on promoter sequences which bind the hematopoietic transcription fa... Mol Cell Biol. 1995 Jan;15(1):58-68.
REF 2 Transcription factors NF-IL6 and CREB recognize a common essential site in the human prointerleukin 1 beta gene. Mol Cell Biol. 1994 Nov;14(11):7285-97.
REF 3 Autocrine interleukin-1beta production in leukemia: evidence for the involvement of mutated RAS. Cancer Res. 1999 Jun 15;59(12):2971-80.
REF 4 Human T-cell leukemia virus type I Tax transactivates the promoter of human prointerleukin-1beta gene through association with two transcription factors, nuclear factor-interleukin-6 and Spi-1. Blood. 1997 Oct 15;90(8):3142-53.
REF 5 Characterization of a functional NF-kappa B site in the human interleukin 1 beta promoter: evidence for a positive autoregulatory loop. Mol Cell Biol. 1993 Oct;13(10):6231-40.
REF 6 NF-kappa B regulates IL-1 beta transcription through a consensus NF-kappa B binding site and a nonconsensus CRE-like site. J Immunol. 1994 Jul 15;153(2):712-23.
REF 7 Transcriptional repression of the prointerleukin 1beta gene by heat shock factor 1. J Biol Chem. 1996 Oct 4;271(40):24874-9.
REF 8 Dietary phenolic acids attenuate multiple stages of protein glycation and high-glucose-stimulated proinflammatory IL-1beta activation by interferin... Mol Nutr Food Res. 2010 Jul;54 Suppl 2:S127-40.
REF 9 IL-4-activated STAT-6 inhibits IFN-gamma-induced CD40 gene expression in macrophages/microglia. J Immunol. 2000 Dec 1;165(11):6235-43.
REF 10 PU.1 (Spi-1) and C/EBP alpha regulate the granulocyte colony-stimulating factor receptor promoter in myeloid cells. Blood. 1996 Aug 15;88(4):1234-47.
REF 11 Identification and characterization of a novel Ets-2-related nuclear complex implicated in the activation of the human interleukin-12 p40 gene prom... J Biol Chem. 1997 Apr 18;272(16):10389-95.
REF 12 CD18 (beta 2 leukocyte integrin) promoter requires PU.1 transcription factor for myeloid activity. Proc Natl Acad Sci U S A. 1995 Jan 31;92(3):801-5.
REF 13 Induction of bcl-2 expression by phosphorylated CREB proteins during B-cell activation and rescue from apoptosis. Mol Cell Biol. 1996 Oct;16(10):5546-56.
REF 14 The proximal regulatory element of the interferon-gamma promoter mediates selective expression in T cells. J Biol Chem. 1996 Dec 13;271(50):31964-72.
REF 15 An AP-1 site in the promoter of the human IL-5R alpha gene is necessary for promoter activity in eosinophilic HL60 cells. FEBS Lett. 1998 Sep 4;434(3):251-4.
REF 16 Cyclic AMP inhibits fibronectin gene expression in a newly developed granulosa cell line by a mechanism that suppresses cAMP-responsive element-dependent transcriptional activation. J Biol Chem. 1990 Oct 25;265(30):18219-26.
REF 17 Functional mapping of a placenta-specific upstream promoter for human gonadotropin-releasing hormone receptor gene. Endocrinology. 2001 Apr;142(4):1506-16.
REF 18 Cyclic AMP- and phorbol ester-induced transcriptional activation are mediated by the same enhancer element in the human vasoactive intestinal peptide gene. J Biol Chem. 1991 Feb 25;266(6):3882-7.
REF 19 The transcription factors ATF-1 and CREB-1 bind constitutively to the hypoxia-inducible factor-1 (HIF-1) DNA recognition site. Nucleic Acids Res. 1995 Nov 25;23(22):4542-50.
REF 20 A redox factor protein, ref1, is involved in negative gene regulation by extracellular calcium. J Biol Chem. 1994 Nov 11;269(45):27855-62.
REF 21 CD4 promoter transactivation by human herpesvirus 6. J Virol. 1998 Nov;72(11):8797-805.
REF 22 Identification of a novel sterol-independent regulatory element in the human low density lipoprotein receptor promoter. J Biol Chem. 2000 Feb 18;275(7):5214-21.
REF 23 Regulatory mechanisms of cAMP-dependent and cell-specific expression of human steroidogenic cytochrome P450scc (CYP11A1) gene. Eur J Biochem. 1994 Jun 15;222(3):825-34.
REF 24 Noradrenergic-specific transcription of the dopamine beta-hydroxylase gene requires synergy of multiple cis-acting elements including at least two Phox2a-binding sites. J Neurosci. 1998 Oct 15;18(20):8247-60.
REF 25 Differential binding of cAMP-responsive-element (CRE)-binding protein-1 and activating transcription factor-2 to a CRE-like element in the human tissue-type plasminogen activator (t-PA) gene promoter correlates with opposite regulation of t-PA by phorbol ester in HT-1080 and HeLa cells. Eur J Biochem. 1996 May 1;237(3):532-8.
REF 26 Granulocyte-macrophage colony-stimulating factor and interleukin-3 signaling pathways converge on the CREB-binding site in the human egr-1 promoter. Mol Cell Biol. 1994 Sep;14(9):5975-85.
REF 27 Brain-specific expression of the human transferrin gene. Similar elements govern transcription in oligodendrocytes and in a neuronal cell line. J Biol Chem. 1994 Sep 30;269(39):24504-10.
REF 28 Identification and characterization of a 315-base pair enhancer, located more than 55 kilobases 5' of the apolipoprotein B gene, that confers expression in the intestine. J Biol Chem. 2000 Aug 25;275(34):26637-48.
REF 29 Transcriptional regulation by C/EBP alpha and -beta in the expression of the gene for the MRP14 myeloid calcium binding protein. Cell Struct Funct. 1998 Jun;23(3):109-18.
REF 30 cis-acting elements and transcription factors involved in the promoter activity of the human factor VIII gene. J Biol Chem. 1995 May 19;270(20):11828-38.
REF 31 Regulatory elements and transcription factors controlling basal and cytokine-induced expression of the gene encoding intercellular adhesion molecule 1. Proc Natl Acad Sci U S A. 1994 Nov 22;91(24):11641-5.
REF 32 The alpha2 and alpha5 integrin genes: identification of transcription factors that regulate promoter activity in epidermal keratinocytes. FEBS Lett. 2000 Jun 2;474(2-3):201-7.
REF 33 The human topoisomerase I gene promoter is regulated by NF-IL6. Mol Cell Biol. 1995 Dec;15(12):6623-31.
REF 34 Identification of a transcriptional regulatory factor for human aromatase cytochrome P450 gene expression as nuclear factor interleukin-6 (NF-IL6), a member of the CCAAT/enhancer-binding protein family. Eur J Biochem. 1995 Jul 15;231(2):292-9.
REF 35 Constitutive and IL-6-induced nuclear factors that interact with the human C-reactive protein promoter. EMBO J. 1990 Feb;9(2):457-65.
REF 36 CCAAT/enhancer-binding proteins are mediators in the protein kinase A-dependent activation of the decidual prolactin promoter. J Biol Chem. 1999 Aug 27;274(35):24808-18.
REF 37 The c-rel protooncogene product c-Rel but not NF-kappa B binds to the intronic region of the human interferon-gamma gene at a site related to an in... Proc Natl Acad Sci U S A. 1992 Mar 1;89(5):1740-4.
REF 38 Kappa B site-dependent activation of the interleukin-2 receptor alpha-chain gene promoter by human c-Rel. Mol Cell Biol. 1992 Sep;12(9):4067-75.
REF 39 The transcriptional regulation of human arachidonate 12-lipoxygenase gene by NF kappa B/Rel. FEBS Lett. 1995 Apr 17;363(1-2):105-10.
REF 40 Apo CIII gene transcription is regulated by a cytokine inducible NF-kappa B element. Nucleic Acids Res. 1994 Jun 25;22(12):2417-22.
REF 41 NF-kappaB1 (p50) homodimers contribute to transcription of the bcl-2 oncogene. J Biol Chem. 2001 Nov 30;276(48):45380-6.
REF 42 Endothelial interferon regulatory factor 1 cooperates with NF-kappa B as a transcriptional activator of vascular cell adhesion molecule 1. Mol Cell Biol. 1995 May;15(5):2558-69.
REF 43 Inhibition of IL-12 production by 1,25-dihydroxyvitamin D3. Involvement of NF-kappaB downregulation in transcriptional repression of the p40 gene. J Clin Invest. 1998 Jan 1;101(1):252-62.
REF 44 Flanking sequences for the human intercellular adhesion molecule-1 NF-kappaB response element are necessary for tumor necrosis factor alpha-induced gene expression. J Biol Chem. 1997 Jun 20;272(25):15928-35.
REF 45 Expression of human p53 requires synergistic activation of transcription from the p53 promoter by AP-1, NF-kappaB and Myc/Max. Oncogene. 1999 Apr 29;18(17):2728-38.
REF 46 Inhibition of NF-AT-dependent transcription by NF-kappa B: implications for differential gene expression in T helper cell subsets. Proc Natl Acad Sci U S A. 1995 Dec 5;92(25):11623-7.
REF 47 Synergy between interferon-gamma and tumor necrosis factor-alpha in transcriptional activation is mediated by cooperation between signal transducer and activator of transcription 1 and nuclear factor kappaB. J Biol Chem. 1997 Jun 6;272(23):14899-907.
REF 48 Transcriptional regulation of the intercellular adhesion molecule-1 gene by inflammatory cytokines in human endothelial cells. Essential roles of a variant NF-kappa B site and p65 homodimers. J Biol Chem. 1995 Jan 13;270(2):933-43.
REF 49 Transcription factors ets1, NF-kappa B, and Sp1 are major determinants of the promoter activity of the human protein kinase CK2alpha gene. J Biol Chem. 2000 Jun 16;275(24):18327-36.
REF 50 KiSS-1 represses 92-kDa type IV collagenase expression by down-regulating NF-kappa B binding to the promoter as a consequence of Ikappa Balpha -ind... J Biol Chem. 2001 Jan 12;276(2):1164-72.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.